Protein Info for Shew_2673 in Shewanella loihica PV-4

Name: caiC
Annotation: putative crotonobetaine/carnitine-CoA ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 225 to 245 (21 residues), see Phobius details PF00501: AMP-binding" amino acids 14 to 383 (370 residues), 257.3 bits, see alignment E=2.1e-80 PF13193: AMP-binding_C" amino acids 434 to 506 (73 residues), 63.7 bits, see alignment E=2.5e-21

Best Hits

KEGG orthology group: K02182, crotonobetaine/carnitine-CoA ligase [EC: 6.2.1.-] (inferred from 100% identity to slo:Shew_2673)

Predicted SEED Role

"Crotonobetaine carnitine-CoA ligase (EC 6.3.2.-)" (EC 6.3.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-, 6.3.2.-

Use Curated BLAST to search for 6.2.1.- or 6.3.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGE1 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Shew_2673 putative crotonobetaine/carnitine-CoA ligase (RefSeq) (Shewanella loihica PV-4)
MDIVGSRTLRCMWQERAQQYSDNTALIYEDAGGDIRTFTYQSLDAQINRAANLFLKQGIA
KGDKVAVQLYNSPEFIFCWFGLAKIGAVIVPINTQYVQGECSYILTKCDVTALVTEPSFL
PIYEALAAKGQRLEQVFVARAAGEQFAGRVNFDDQLALQAPTLDLHVPLESEDPAEILFT
SGTTSLPKGVVLTHCNLQFAGHYTAWQTRLTAKDRYLSMMPNFHIDFQCNAAMAVFTVGA
CLVMLEKYSARRFWKQICDYRATLTHSMPMILRTLMLQPVAEGEDQHCLRDMLFFMHISD
QEKLDFETRFKVTLFNSYGMTETLVGLIGDTPGEPRHWPSIGRPGLGYEAKVIDETGREV
PPNVVGDLWVKGVPGRSLFKEYYQDPQATEAVLRRDGWLITGDKAYVDERGLFYFVDRKS
NMIKRSGENISSTEVENVLMSHPAIQDAAVIGVADPIRDQAVKAFVIFAPGMSLTVEEIL
AFCSANMAKFKVPSYVEIREAFPRTCTCKVDKKLLETR