Protein Info for Shew_2671 in Shewanella loihica PV-4

Annotation: alpha/beta hydrolase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF00135: COesterase" amino acids 67 to 175 (109 residues), 29.6 bits, see alignment E=7.6e-11 PF20434: BD-FAE" amino acids 79 to 174 (96 residues), 74.4 bits, see alignment E=2e-24 PF07859: Abhydrolase_3" amino acids 85 to 291 (207 residues), 234 bits, see alignment E=3.3e-73 PF00326: Peptidase_S9" amino acids 133 to 298 (166 residues), 32.2 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2671)

Predicted SEED Role

"Lipase/esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGD9 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Shew_2671 alpha/beta hydrolase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MPLDPEVAQFLQEVEDSGAPAYETMTPAEARRQELTDLAIANAGKTPEAVSEVIHSFIPG
PTADLPVRIYRPLGIEVPEAGAPALIFIHGSGWVVSNIETNDHFSRALANRTGAVVIAAN
YQKAPEHKFPIPMDDCYNATLWVFEQAKALGLDPKRIGIMGDSAGGNLAAAVTLRLRDEM
GPLLACQVLVYPAVHYGWDTDSAKLHGTGYLLQRESMKYYWGHYLRSPADGQNPYCSPLD
AASHSCLPPALIYTAEYDPLCDDGFNYAQKLKLAGVPVSYKMYEGTIHGFIKMLQRFTLA
QTFLDELSEAVRPLLALQGE