Protein Info for Shew_2631 in Shewanella loihica PV-4

Annotation: undecaprenyl diphosphate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 24 to 251 (228 residues), 314 bits, see alignment E=2.6e-98 PF01255: Prenyltransf" amino acids 31 to 251 (221 residues), 282.6 bits, see alignment E=1e-88

Best Hits

Swiss-Prot: 85% identical to UPPS_SHEON: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (uppS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 100% identity to slo:Shew_2631)

MetaCyc: 63% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG99 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Shew_2631 undecaprenyl diphosphate synthase (RefSeq) (Shewanella loihica PV-4)
MSIESQSGSELSNEALAELVKQSIPKHVAIIMDGNGRWAQAQGKPRVVGHKAGVKTVRRA
VSMAREMGIGSLTLFAFSSENWRRPEKEVSLLMELFFTVLQREIKLLDKNGVRLNIIGDI
SRFSARLQKQIAAAMEKTANNTGLILNVAANYGGRWDIVQAAQTLAKKVESGEMTSSQFT
EEALSQHLSMQNQPEVDLMIRTGGDFRISNFVLWQAAYAELVFTDVLWPDFDEQAFKDAV
AVFATRQRRFGLTGSQIETLQAE