Protein Info for Shew_2625 in Shewanella loihica PV-4

Annotation: UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 8 to 329 (322 residues), 373.1 bits, see alignment E=5.2e-116 PF04613: LpxD" amino acids 23 to 89 (67 residues), 84.2 bits, see alignment E=4.4e-28 PF00132: Hexapep" amino acids 128 to 160 (33 residues), 36 bits, see alignment 3.7e-13 amino acids 145 to 179 (35 residues), 32.5 bits, see alignment 4.7e-12 amino acids 222 to 256 (35 residues), 27.3 bits, see alignment 2.2e-10

Best Hits

Swiss-Prot: 76% identical to LPXD_SHEFN: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to slo:Shew_2625)

MetaCyc: 54% identical to UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Vibrio cholerae O1 biovar El Tor str. N16961)
RXN-23221 [EC: 2.3.1.191]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG93 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Shew_2625 UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase (RefSeq) (Shewanella loihica PV-4)
MTSYTLSEIAAHLNAEVKGDETVTIHRVATLEKAQAGEISFLANPKYQSQLEGTAASAVL
LSPKMAEHYSGNALVLADPYVGFARVAQLLDTTPKAAEAIHPSAVIDPSAQLGEGVAIGA
NAVIGAKVILGENVQVGPGCVLGQDVIVGSNSILWANVTLYHDVQLGTDCIVHSGTVIGS
DGFGYANERGLWIKIPQTGGVRIGNRVEIGACTSIDRGALDHTEIHDGVIIDNQVQLAHN
VVVGENTALAGSSTFAGSCNIGKYCIIGGSSAVAGHLSIADGTHISGGTNVTSVIREPGV
YSSATVAMENKLWRRNTVRFRQLDELFQRVKQLEKNVKSDD