Protein Info for Shew_2623 in Shewanella loihica PV-4

Annotation: UDP-N-acetylglucosamine acyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase
  • amino acids 2 to 253 (252 residues), 345.8 bits, E=6.3e-108
• PF25087: GMPPB_C
  • amino acids 6 to 100 (95 residues), 38.3 bits, E=1.5e-13
• PF00132: Hexapep
  • amino acids 11 to 46 (36 residues), 45.5 bits, 5.8e-16
  • amino acids 103 to 137 (35 residues), 34.9 bits, 1.3e-12
• PF13720: Acetyltransf_11
  • amino acids 174 to 254 (81 residues), 97.7 bits, E=6.4e-32

Best Hits

Swiss-Prot: 57% identical to LPXA_AERHH: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 100% identity to slo:Shew_2623)

MetaCyc: 59% identical to acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Vibrio cholerae O1 biovar El Tor str. N16961)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (15/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (15/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

See A3QG91 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Shew_2623 UDP-N-acetylglucosamine acyltransferase (RefSeq) (Shewanella loihica PV-4)
MIDKLAFVHPDAKIGNNVTIGPWTYIGPDVEIGDDCHLSSHVVVKGPTVIGKGNRIFQFA
SVGEDCQDKKYAGEPTRLIIGDNNVIRESVTIHRGTVQDNSETRIGSNNLFMAYVHIAHD
CVVGNNVIMANNASIAGHVHVGDWAILGGMTGVHQFVHIGAHAFTAGYSLILQDVPPFVM
ASGQPAIPRGLNSEGMKRRGFSKESQLAVRRAYKTLYRKGLTIEEAVAALGEDAEDEQVK
LLMDFVVNSSRGIIR