Protein Info for Shew_2617 in Shewanella loihica PV-4

Annotation: potassium efflux system protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 13 to 284 (272 residues), 254.9 bits, see alignment E=5e-80 PF00999: Na_H_Exchanger" amino acids 15 to 373 (359 residues), 213.2 bits, see alignment E=8.4e-67 PF02254: TrkA_N" amino acids 408 to 521 (114 residues), 81.3 bits, see alignment E=1e-26 PF02080: TrkA_C" amino acids 577 to 646 (70 residues), 40.7 bits, see alignment E=2.7e-14

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 100% identity to slo:Shew_2617)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG85 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Shew_2617 potassium efflux system protein (RefSeq) (Shewanella loihica PV-4)
MEHSILIKILLMLMMAIVAIALFRRAGLPAILAYLITGVISGPSVFNWFTQQQIHSVAEL
GVVLLMFSLGLEFSLPRLWAMRRTVFGLGSAQVFVTAVLTMCISMLLGLNLSESIVVGSA
IALSSTAIVLKLLNERGWLRRRHGELSVSVLLFQDLAVVPLLILMPLLASDGEMLSWHQI
LLAMGEGVLAFIALMAVGKWALPKVFDEVARSRSNELFVLSTLVVALVTGALTQWLGLSM
ALGAFIAGMLLGESQYKRQLEADIRPFRDLLMGLFFISIGMLLDFSLVITFWWQVLLLVV
AVIIAKALIVFGLLRAAKESFRTSVATAISLAQVGEFSFVVLALAVNYQLLEITVSTKLV
MVAVLSMAVAPWLVRHSVDIARRLHGVKSVKQGGHETIPIPEQSSDLVLILGYGRVGQTI
ARFMKTEAIPYLVLDRDPTRVSEARRAGEPVYFGDVAKRAILKQAQIKQAKLIVLTFTSS
HVLDEVLPLCRQLAPEAKILVRTRDDEGMEALEEAGASQVIPETLEGSLMLVSQVLYQCG
VPLTRILKRLEYERRNHYQYLHGFFSGEETDFTLELLHAVALPKGAQVVGQPLSAIPWDK
LRVELRAVRRSGAEVESPELDWLIRPGDILIILGKPRRIEKAEHYLLQG