Protein Info for Shew_2554 in Shewanella loihica PV-4

Annotation: outer membrane protein W (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13505: OMP_b-brl" amino acids 13 to 213 (201 residues), 51.6 bits, see alignment E=2.7e-17 PF03922: OmpW" amino acids 26 to 213 (188 residues), 219.6 bits, see alignment E=7.3e-69 PF05736: OprF" amino acids 56 to 176 (121 residues), 26.2 bits, see alignment E=1.3e-09 PF02462: Opacity" amino acids 114 to 182 (69 residues), 27.2 bits, see alignment E=7.2e-10

Best Hits

Swiss-Prot: 52% identical to OMPW_SHIFL: Outer membrane protein W (ompW) from Shigella flexneri

KEGG orthology group: K07275, outer membrane protein (inferred from 100% identity to slo:Shew_2554)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG22 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Shew_2554 outer membrane protein W (RefSeq) (Shewanella loihica PV-4)
MMKKTIVSGLIAAALLSTGFAASAHQAGDIIVRAGGVVVAPNESSEDVAGFGEFNISSNT
QLGLNFGYMLTDNIGIELLAATPFSHDVSLKGVGKIAETKHLPPTLVAQYYFGSADSKLR
PYIGAGVNFTNFFDSEFTNDLDGALTDLSLSNSWGLAAQAGIDYQVNKNWLVNASVWYAK
INTDVNFKLAGQAVSIETDIDPWVYMVSVGYTF