Protein Info for Shew_2473 in Shewanella loihica PV-4

Annotation: tetratricopeptide domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13181: TPR_8" amino acids 85 to 110 (26 residues), 14.5 bits, see alignment (E = 1.3e-05) amino acids 190 to 212 (23 residues), 12.9 bits, see alignment (E = 4.5e-05)

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2473)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFU1 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Shew_2473 tetratricopeptide domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MQKVNTLAAALLLAIGGSLVVAPAANAAEKCPIEKRQSKAVGQSSAKKVQKSFEAYQEGN
IDEAIAVLLEASPRDAFDKAYIARMLGNFYAEKNQMGTAIKYLKQAVDADVLGGTDHGAT
LRLYADLLIQEKKFKESIPYYYEWMKFTCKEDPQVYRRIGIAYSELKEWDKVLGVVDKGL
SISTKPDKGLYQMKLTAYFNKKDYKNAIKVLETMVPLFQEDGRLWVQLAQFYLMTESYDK
SLATYDLAYKNGFLETSGNITRLSQLLAQNGSPYRAAKIYEKHMKSGLIKEDEKTFSILG
GFYHNAKELKEAADYYGKAAAINNDGKLYLKQARLLTLQEKHKEAIPVLKKALAAGGVSE
GEVEFELTLAYLGTKQIKAAYNACLKAAKDEKTKRSATSYLAYIKEKARIYNVAL