Protein Info for Shew_2455 in Shewanella loihica PV-4

Annotation: peptidase M23B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF04225: LysM_OapA" amino acids 72 to 149 (78 residues), 31 bits, see alignment E=3.5e-11 PF19425: Csd3_N2" amino acids 156 to 278 (123 residues), 96.7 bits, see alignment E=1.5e-31 PF01551: Peptidase_M23" amino acids 291 to 385 (95 residues), 115.3 bits, see alignment E=1.9e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2455)

Predicted SEED Role

"Cell wall endopeptidase, family M23/M37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFS3 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Shew_2455 peptidase M23B (RefSeq) (Shewanella loihica PV-4)
MSQSRIMALPSPHKKILLAAGLVVGAALLWPSQKQALPQRIPVALDIESLVTNLHLGDEA
VETVSHADFVKTIVSGDTLSGLFVEANVDQQTMYKVLEADLNILALDTLKPGNIIRFWLD
DSGQLEKLELYFNAARQVVFSRYEEGGFSVDEINIEGIWQDRALSGEIQGSFYLSAQRIG
LNAGEIQRIETLLKEKLNFARDLRAGDRFSVLKSDQYIDGEVTGNSDILAITIERGRSTI
NAYQNSDGNFYDDQGRSLARAFQRVPLQKNYRVSSRFNRHRHHPVTGRTAPHNGTDFATP
IGTKVIAPGDGIVSLVTDHRYAGKYVVIDHGNKYRTRYLHLSKALVHKGQRVSRGQVIAL
SGKTGRITGPHLHYEFHINGRPVDPMKADIPMASKLSKKQMGEFAQLVKVRQMMMGQS