Protein Info for Shew_2452 in Shewanella loihica PV-4

Annotation: DEAD/DEAH box helicase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00270: DEAD" amino acids 38 to 207 (170 residues), 158.8 bits, see alignment E=1.6e-50 PF04851: ResIII" amino acids 54 to 203 (150 residues), 39.7 bits, see alignment E=7.4e-14 PF00271: Helicase_C" amino acids 246 to 354 (109 residues), 102.7 bits, see alignment E=2.2e-33

Best Hits

Swiss-Prot: 40% identical to SRMB_ECOLI: ATP-dependent RNA helicase SrmB (srmB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2452)

MetaCyc: 40% identical to ATP-dependent RNA helicase SrmB (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase VCA0061" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFS0 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Shew_2452 DEAD/DEAH box helicase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MYNAPLSIFRSTALQFSDFSLDKRLLTSLEHMGIDTPTEIQTQSIPVGLSGRDLMASSKT
GSGKTLAFLLPAMQRVIATKALSKRDPRVLILLPTRELATQVYSQLRLLVANTQYKAIKI
LGGENFNDQAKALARDPHFVVATPGRLADHLAQRHLYLNGLELLILDEADRMLDLGFAEQ
LRAINQAADHKRRQTLMFSATLDHGQINEIAAELLKEPEHVAIGASHVENQDIAQKIYLC
DNLSHKEQLLTRLLQLEPHKQVIIFTATRGDTDRLAGVLAEQGFSTSSLSGELKQAARNQ
IMDQFSRGQQQILVTTDVASRGLDLLNVSLVINFDMPKFAEEYIHRIGRTGRAGAKGDAI
SLVGPKDWVNFKQVQNFLRKSFEFSELEELAPKFKGLKDKPSQEKRLGKQQAKPKAKTAK
AASSTKPTKPRDKRFITGVDVGDAPMLRKPKAKLQDTPED