Protein Info for Shew_2443 in Shewanella loihica PV-4

Annotation: peptidase S8 and S53, subtilisin, kexin, sedolisin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 807 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF05922: Inhibitor_I9" amino acids 54 to 136 (83 residues), 36.6 bits, see alignment E=1.5e-12 PF00082: Peptidase_S8" amino acids 162 to 392 (231 residues), 104.4 bits, see alignment E=1.9e-33 amino acids 426 to 554 (129 residues), 56.3 bits, see alignment E=8.2e-19 PF02225: PA" amino acids 390 to 481 (92 residues), 29.6 bits, see alignment E=1.6e-10 PF04151: PPC" amino acids 602 to 669 (68 residues), 76.5 bits, see alignment E=5.9e-25 PF01483: P_proprotein" amino acids 727 to 806 (80 residues), 82.6 bits, see alignment E=4.3e-27

Best Hits

KEGG orthology group: K14645, serine protease [EC: 3.4.21.-] (inferred from 100% identity to slo:Shew_2443)

Predicted SEED Role

"Alkaline serine protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFR1 at UniProt or InterPro

Protein Sequence (807 amino acids)

>Shew_2443 peptidase S8 and S53, subtilisin, kexin, sedolisin (RefSeq) (Shewanella loihica PV-4)
MEDNMTVKKTTAVAMSLSALALAIAANVNAAPAKGLHLQADNARINQASPLPKRYIVKFK
NAQAAAQADANSLNDYQPRANEVFSQHRALNSVKAKQMKRIGRSNAYSAQLDNNGVKALK
LRADVDYVEEDMPRHLLSETTPWGQTFVGATSLSDSMAGNRTICIIDSGYDRSHSELSGN
NVTGTNNSGTGNWYEPGAHNAHGTHVAGTIAAIANNDGVVGVMPNQNANIHVVKVFNSDG
WGYSSSLVSAVDTCVANGANVVTMSLGGSQSTTTEKNALAAHANNGVLLIAAAGNDGNNT
HSYPASYDAVMSVAAVDNNKDHAAFSQYTNQVEISGPGEAILSTVTRGEGRLANITAGTQ
SYFDNGVVPHNRYVKDSSGNYVGTPITGSVTAELAECSVSGGVFNCGDMTGKVCLVERVG
NQGASYPEIDAVKACNNAGAQAAIVFSNTALPGLQNPFLVDTNNEAPMVSVSVDRATGQA
LRAHLGTNVTVANTSGEDYEYYNGTSMATPHVSGVATLVWSYHPECSAAQVRAALTATAE
DLDVAGRDDKTGYGLVNAVAAKEYLDASCNGPTDPGTGTGGNVLENGVAKTNLTGVKGDE
LHFSIDVPAGASDLNFAMSGGTGDADLYVQYGAAPTLSSYDCRPWKGGNSESCPVSTPQA
GTYYVMVQGYSDFSGVSLTASYTEQSTGGNTGGPATYTNNTSYAIPDNNTAGISSPIDVT
RSGDSGTVTVTVNITHTYIGDLQVELHSPSGQVAVLHDNSGGSADNIIKSYTVDMSGVES
AGTWTLKAVDSARRDTGTIDAWQLSFQ