Protein Info for Shew_2436 in Shewanella loihica PV-4

Annotation: membrane protein involved in aromatic hydrocarbon degradation (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03349: Toluene_X" amino acids 14 to 438 (425 residues), 352.7 bits, see alignment E=2.2e-109 PF13609: Porin_4" amino acids 107 to 397 (291 residues), 27.3 bits, see alignment E=3.3e-10

Best Hits

KEGG orthology group: K06076, long-chain fatty acid transport protein (inferred from 100% identity to slo:Shew_2436)

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFQ4 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Shew_2436 membrane protein involved in aromatic hydrocarbon degradation (RefSeq) (Shewanella loihica PV-4)
MKRFNKTILAVAVTLASSQAMAAGFQLNSQSATGVGRAFAGDAVIADNASVLSRNPAAMA
LFDEKQLSMGLTYADVEVSVKDVYIDSLVGPIHYGHVDDAAEAKIIPNFYYVSPVNDKFA
YGVAMFSNFGTGTDTTPMSQQLVNGLPAPLDLLGKTEVTTLNFNLSASYRFNDHFSVGAG
VDVIYGQGTLTRGGLVPTQAGAVQQDLVDVDADGVAFGGIIGAVYEINADHRFGMSYRFS
PDFKATGDINMYNPVAGANVAFDEINIPMPDIFQVAGFHQLTEKFALHYTAQLTTWGDFK
EITVTDGTIGGVPVAPEASLKTYAWDDSWLFSVGGTYTLNQDWTVRAGYMFDQGVVGEVS
SISIPDSDRQWFTAGATYNLGKHASLDFGVAFIRGEDVDLIEHSAITGGLPIGPDTGMVH
ATTRSNATYYSMQYNYKF