Protein Info for Shew_2430 in Shewanella loihica PV-4

Annotation: von Willebrand factor, type A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 60 to 80 (21 residues), see Phobius details amino acids 305 to 330 (26 residues), see Phobius details PF01882: DUF58" amino acids 90 to 206 (117 residues), 23.5 bits, see alignment E=6.4e-09 PF06707: DUF1194" amino acids 91 to 235 (145 residues), 30.1 bits, see alignment E=5.7e-11 PF00092: VWA" amino acids 91 to 283 (193 residues), 79.8 bits, see alignment E=5.9e-26 PF13519: VWA_2" amino acids 92 to 203 (112 residues), 66.5 bits, see alignment E=6.2e-22

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to slo:Shew_2430)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFP8 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Shew_2430 von Willebrand factor, type A (RefSeq) (Shewanella loihica PV-4)
MFTLAWPWLLILLPLPLIFSLGKASGSKQATQTGGGHLQMPGVAEAPTTRFDHSPRRSRW
PYWLIWTALVFAVARPLWVGDAIELPSKGRDLMLAVDLSGSMQIEDMVLNGKAVDRFAMV
QQVMSEFIERRKGDKLGLILFADHAYLQAPLTQDRRSVAQFLTEAQIGLVGKQTAIGEAI
ALAVKRFDKAKQSNRVLILLTDGSNNSGSITPEQAADIAAKRGVTIYTIGVGAEVMERRT
LFGKERVNPSMDLDEAQLTLLAQKTKGRYFRARNSDELEQIYQEIDKLEPTDSDQLSYRP
QAELFYYPLAIALLVSVLLMLSGFAAVQALVQRLPRSAS