Protein Info for Shew_2415 in Shewanella loihica PV-4

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 304 to 307 (4 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details PF12832: MFS_1_like" amino acids 26 to 374 (349 residues), 355.7 bits, see alignment E=5e-110 PF03825: Nuc_H_symport" amino acids 32 to 390 (359 residues), 60.8 bits, see alignment E=2e-20 PF07690: MFS_1" amino acids 222 to 399 (178 residues), 49.8 bits, see alignment E=3.9e-17

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 100% identity to slo:Shew_2415)

Predicted SEED Role

"Nucleoside:H+ symporter:Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFN3 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Shew_2415 major facilitator transporter (RefSeq) (Shewanella loihica PV-4)
MSSNAQSSTSMSPNGMQQSDPQHQLHWISACYFFFFAILGVLVPYLGVFFENRGFDAQQI
GFLLAILMATRIIAPNIWAMVADKTGMRGQLVKMGAACSAVTFMSFFYHGGFVYLAISLS
IYTFFWNAILAQLEVITLETLGENTGGYGKIRSFGSLGYLVFVVSVGFAISQFGTEILPF
VGLALFLGLLGCSLSLPSTRVKVDKSQVPTPLKLDAGIIWFLLSAMLLQMSAGPFYGFFV
LYLKQVGYSESSAGIYVALGVLAEIVMFMFAPRLLGRYGVSALLVLSIGFTAVRWLLMAF
CASNMVWLGVSQLLHAFTFGLVHAASIQFVHQRFDVRHRSKGQALYASLSFGVGGALGTW
LCGFIWGDGSQAWLSWLAAAVCALLSMLAVLLIPKTREVAKQ