Protein Info for Shew_2401 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 247 to 268 (22 residues), see Phobius details amino acids 292 to 317 (26 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 406 to 429 (24 residues), see Phobius details amino acids 458 to 477 (20 residues), see Phobius details amino acids 690 to 711 (22 residues), see Phobius details amino acids 745 to 767 (23 residues), see Phobius details amino acids 782 to 800 (19 residues), see Phobius details PF02687: FtsX" amino acids 250 to 367 (118 residues), 38.8 bits, see alignment E=4.5e-14 amino acids 696 to 800 (105 residues), 40.3 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2401)

Predicted SEED Role

"FIG00809136: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFL9 at UniProt or InterPro

Protein Sequence (816 amino acids)

>Shew_2401 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MESRIAWKLFKRELLQGQLLLIILAITLAVFSVSGLARVSERLQLAINGQASKFIAADRI
INSPVPLDDKILAKADALGLRHVASMQFNSMAYAGDAFQLVTVKAVGEGYPLKGVIELSD
GPTDKLPKADQLWYETRLGGILGYPKQLELGNANFSLSAEIARLPDAGFNPFASSPVVLM
RLQDVPKTGVIQPGSRVSYIHQFAGEADQLKAFEAEVKPLLNNSQRWVDVQSGDSPIAGA
VKRAERFLLLASLLGIALACAAIGIAAQRYCQRHFDVVAMLKTFGASSRQIRILFGLHLL
LVTLAGIALGLIGGFLLDTLISAYLPASISAYSPPLFRPIALGVATGLISAFMFSAYPLM
RLLAIPPLRVLQRQLEGIQLGMWLHLVLSLSAMALLGYLYSQSLVLTLTVVAAVMLLGVL
LSLFGFLLIRAGHSVGMKTTNPMQLALAGLRRRARQNAVQLVGFSSALVLLLTIIALRQD
LLDEWHKQLPEQSPNYFLVNIAPEEQAPLEAYFSDNRVKATDIYPVIRGRLVAINGEKLI
SAEQADEGAQGRVGISRELNLTWRTSLPPNNELLSGHFNQKADEVSVESGVAERLGIGLG
DELSYVIDNQPLTVKVASIRAVHWETMQPNFFMIFHPDALAPFAYTSMASFYLDDSKRPM
VIELIKRFPTVSIIDVGAMVKQLRQIIDQVSLSLTLVLVLVLLASSLVMIAQTEAGMATR
QRELAVLRTFGASGWLLRMATALEFALLGLIAGLLAAIVAEFTIYLLKTQVFELVVYMHW
DWWLLAPLAGAAIVALLGTWRCRQLLQKSCRQLLQG