Protein Info for Shew_2389 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 63 to 84 (22 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 140 to 167 (28 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details amino acids 439 to 461 (23 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details PF11840: DUF3360" amino acids 10 to 510 (501 residues), 1043.4 bits, see alignment E=0

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2389)

Predicted SEED Role

"FIG01056694: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFK7 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Shew_2389 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MSETVKKEEMEASELTYKALHRPASEFATREEYLDHELQIMKPRRWGLNLPGRDFRFEWE
DLVPAIAGTIGITVMYSAVMAAWASGLSERWEHINLGAEFAIQVVRVEMLIPALLFCIIS
SGFINPRANLGGNHGPMIPLIGTIALAGAHPLALAILLGIFGLLLSYFKGGSRLVNLTSS
GVAGGLLVFLGFMGAKSQITSLFDWAGGLQAKHALDYSLGYVAFFILLVNVVLYAYLAKV
GKRWLAIPLCSIAAIALAFALGAGLDLQFVTAPGIPNLNPVYWWGSTEHGWQLGLPNFEH
FIASLPFAILAVAMWSPDFLGHRIFQELNYPKGTEKVLMDVDDTMTTCSLRQIVGTAVGG
GNITSSWGTYMIPAAIAKRPIPAGAILLGSLCIIVAVLGYPMDVTVWRPVMSIALLVGVF
LPLLEAGMQMVKDTQSSQAAGICIFASFVANPVLAWALTMLLDNNGLIGDKERAASLSLA
DRLIIPGLAFVICLAAMLAVGMIQGIPALL