Protein Info for Shew_2362 in Shewanella loihica PV-4

Annotation: dihydrodipicolinate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF00701: DHDPS" amino acids 6 to 289 (284 residues), 208.8 bits, see alignment E=3.7e-66 TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase" amino acids 8 to 290 (283 residues), 209.4 bits, see alignment E=2.5e-66

Best Hits

Swiss-Prot: 31% identical to DAPA_HALMA: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 100% identity to slo:Shew_2362)

Predicted SEED Role

"1-pyrroline-4-hydroxy-2-carboxylate deaminase (EC 3.5.4.22)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.5.4.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.52

Use Curated BLAST to search for 3.5.4.22 or 4.2.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFI0 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Shew_2362 dihydrodipicolinate synthase (RefSeq) (Shewanella loihica PV-4)
MKVNWQGVFPAISTQFNDDGSINYESNARMLEDLIRDGIDGVIALGTIGENASLSPEEKR
EFIKHTVETVNGRILVLSGCTENTAQQAAKYAQDVEALGVDGLMLLPAMVYRGTDREVIA
HYQHVARSTKLPIMIYNNPVGYGVDINLEMTAVLAEEPNIVAIKESTTDTRRLTELQSRF
GDRFNILCGVDDIALESILLGATGWISGLTNVFPRESVTLFKLARAGRIEEAREIYRWFM
PLLRLDTIPTLVQCIKFAEQIVGRGSENVRLPRMTLIGDERAYVEKVMAEALATRLDLDK
YNLN