Protein Info for Shew_2361 in Shewanella loihica PV-4

Annotation: proline racemase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 74 to 90 (17 residues), see Phobius details PF05544: Pro_racemase" amino acids 20 to 343 (324 residues), 335.1 bits, see alignment E=2.1e-104

Best Hits

Swiss-Prot: 70% identical to Y1705_SHEPA: Protein Spea_1705 (Spea_1705) from Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

KEGG orthology group: K01777, proline racemase [EC: 5.1.1.4] (inferred from 100% identity to slo:Shew_2361)

Predicted SEED Role

"Not a Proline racemase, nor 4-hydroxyproline epimerase [missing catalytic residues]" in subsystem Proline, 4-hydroxyproline uptake and utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFH9 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Shew_2361 proline racemase (RefSeq) (Shewanella loihica PV-4)
MRLLDLSPSFLDACTRFKTLDAHTEGEPLRILLEGYPEIPGDTILAKRRYLTAHLDQYRK
LLMHEPRGHADMYGAIITAPITTGADFGVLFLHNEGYSSMCGHGILALVTVAVETGTLAL
GDTPREIKIDAPAGLIHAKAYRDETGELKVSFRNVPSWAEALDCRVTVEGIGEVAYDIGF
GGAYYAYVDADGLGLSCAPENVAQLIDWGRRIKHAVMAQHPLAHPLEADLGFLYGTIFTS
SKTSSNDAHSRHVCVFADGEVDRSPTGTGVAGRIALLHARGEVALGERLRIESIVDGAMQ
VCALDNADFYGKAAVIPEVSGRAFITGRHEFILDPKDQFQQGFMLR