Protein Info for Shew_2351 in Shewanella loihica PV-4

Annotation: metal dependent phosphohydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF11871: DUF3391" amino acids 5 to 138 (134 residues), 111.7 bits, see alignment E=6e-36 TIGR00277: HDIG domain" amino acids 168 to 261 (94 residues), 36.2 bits, see alignment E=2.2e-13 PF01966: HD" amino acids 171 to 286 (116 residues), 59.2 bits, see alignment E=7.2e-20 PF13487: HD_5" amino acids 177 to 320 (144 residues), 90.2 bits, see alignment E=2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2351)

Predicted SEED Role

"HDIG domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFG9 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Shew_2351 metal dependent phosphohydrolase (RefSeq) (Shewanella loihica PV-4)
MSRSCKVNTNQLQVGNFVRLPVSWKDHPFLFNSFRLKQEAQIELIKKLGIEYVFVDLDKS
SAPPLGKEDAYDAPSFRDDGDLTKLSQQMNQNKQERIEHLKKLKRDLKKTEQEFDRSVAM
MRNLIAKLRNRPLNAISDAKELINSITEELLNSDNLVLHLMSDAKDSDGIYYHSLNVAVL
SMMIAKELDWPREDIEAVGMGALFHDTGKLKIPPQLLRKKTPLTQPELNFIRQHPAMGIE
LLKLANNFPEDAAPIVRDHHEFLDGSGYPRGLKAEQISLPTQLVAAVNLYDQLCHPEGQV
KARTPYAALGYLYKNYKERLNQEAIGKLIKMLGVYPPGSVVELSSGQYAMVMAVNLEKIL
FPRILVYDALVPKEQAPIVDLESEGLTIVRCIAPSALPEKIFKYLSPRERVSYFFGGDKK
A