Protein Info for Shew_2336 in Shewanella loihica PV-4
Annotation: preprotein translocase, YajC subunit (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to YAJC_HAEIN: Sec translocon accessory complex subunit YajC (yajC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 97% identity to swp:swp_1678)MetaCyc: 59% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QFF4 at UniProt or InterPro
Protein Sequence (91 amino acids)
>Shew_2336 preprotein translocase, YajC subunit (RefSeq) (Shewanella loihica PV-4) MELVFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLSKGDEVLTSGGILGKIAKISDDND YVLLTINETSEITIKKDYIAAVLPKGSIKSL