Protein Info for Shew_2336 in Shewanella loihica PV-4

Annotation: preprotein translocase, YajC subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 signal peptide" amino acids 5 to 5 (1 residues), see Phobius details amino acids 22 to 23 (2 residues), see Phobius details transmembrane" amino acids 6 to 21 (16 residues), see Phobius details TIGR00739: preprotein translocase, YajC subunit" amino acids 2 to 83 (82 residues), 104.1 bits, see alignment E=1.7e-34 PF02699: YajC" amino acids 3 to 80 (78 residues), 95.1 bits, see alignment E=9.4e-32

Best Hits

Swiss-Prot: 62% identical to YAJC_HAEIN: Sec translocon accessory complex subunit YajC (yajC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 97% identity to swp:swp_1678)

MetaCyc: 59% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFF4 at UniProt or InterPro

Protein Sequence (91 amino acids)

>Shew_2336 preprotein translocase, YajC subunit (RefSeq) (Shewanella loihica PV-4)
MELVFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLSKGDEVLTSGGILGKIAKISDDND
YVLLTINETSEITIKKDYIAAVLPKGSIKSL