Protein Info for Shew_2312 in Shewanella loihica PV-4

Annotation: ferredoxin, 2Fe-2S type, ISC system (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR02007: ferredoxin, 2Fe-2S type, ISC system" amino acids 2 to 110 (109 residues), 191 bits, see alignment E=2.3e-61 PF00111: Fer2" amino acids 13 to 91 (79 residues), 55 bits, see alignment E=3.2e-19

Best Hits

Swiss-Prot: 80% identical to FER_PSEAE: 2Fe-2S ferredoxin (fdx) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04755, ferredoxin, 2Fe-2S (inferred from 100% identity to slo:Shew_2312)

MetaCyc: 78% identical to reduced ferredoxin (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFD0 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Shew_2312 ferredoxin, 2Fe-2S type, ISC system (RefSeq) (Shewanella loihica PV-4)
MPQIVFLPHEELCPDGAVVEAQVGETVLDVALRNGITIEHACEKSCACTTCHVIIREGFD
ELEESDELEDDMLDKAWGLEPESRLSCQSKVPDSDLVVEIPKYTINMVSEG