Protein Info for Shew_2285 in Shewanella loihica PV-4

Annotation: UDP-glucose 4-epimerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05368: NmrA
  • amino acids 15 to 139 (125 residues), 27.1 bits, E=1.5e-09
• PF04321: RmlD_sub_bind
  • amino acids 16 to 176 (161 residues), 46.9 bits, E=1e-15
• PF01370: Epimerase
  • amino acids 18 to 276 (259 residues), 199.4 bits, E=3.3e-62
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 18 to 349 (332 residues), 444.5 bits, E=9.6e-138
• PF02719: Polysacc_synt_2
  • amino acids 18 to 198 (181 residues), 69.9 bits, E=1.1e-22
• PF08659: KR
  • amino acids 18 to 145 (128 residues), 27.2 bits, E=1.7e-09
• PF00106: adh_short
  • amino acids 18 to 124 (107 residues), 31.8 bits, E=5.2e-11
• PF01073: 3Beta_HSD
  • amino acids 19 to 175 (157 residues), 61.5 bits, E=3.4e-20
• PF16363: GDP_Man_Dehyd
  • amino acids 19 to 338 (320 residues), 192.2 bits, E=8.7e-60
• PF07993: NAD_binding_4
  • amino acids 20 to 186 (167 residues), 28.7 bits, E=3.8e-10
• PF13460: NAD_binding_10
  • amino acids 22 to 147 (126 residues), 36.3 bits, E=2.8e-12

Best Hits

Swiss-Prot: 58% identical to GALE_BACSU: UDP-glucose 4-epimerase (galE) from Bacillus subtilis (strain 168)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to slo:Shew_2285)

MetaCyc: 58% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• stachyose degradation (5/7 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (3/6 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• UDP-sugars interconversion (1/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (1/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

See A3QFA3 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Shew_2285 UDP-glucose 4-epimerase (RefSeq) (Shewanella loihica PV-4)
MSPGGKEVPEMKGEKMSILVTGGAGYIGSHACVELLSAGHQLVVLDNLSRAKFESLARVE
QITAAKLTFVEGDIRDERTLDALFSHYHIDAVMHFAGLKAVGESTRLPLEYYDNNVVGSM
RLLSAMTRHGVKTLVFSSSATVYGANPPLPIMEAAPRSSTNPYGQTKLVVEQMCAEWANA
KQDVSVILLRYFNPVGAHESGLIGEDPKGEPNNLLPYITQVAMGHRPYLSVFGSDYATTD
GTGVRDYIHVMDLVQGHLAALTRLHGVAGCHTFNLGSGQGYSVLEMVRAFEQASGKDIAL
HMAPRRPGDIAASYACPDKAARELDWRVARDLSQMMQDSWRWQCRNPRGYS