Protein Info for Shew_2263 in Shewanella loihica PV-4

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details PF00015: MCPsignal" amino acids 266 to 446 (181 residues), 134.3 bits, see alignment E=2.1e-43

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to slo:Shew_2263)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF81 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Shew_2263 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella loihica PV-4)
MKAIQFRKIDALLIKLSLNGKFWVVCSMVTAITLTIALLNLNAANNQLHAGSAARVQASV
DAYAKVASQMGLSGEALARFAQDNSLRLASRDEQSRRGDSVTASAPVAGQYLQLSQDVAA
WEAEGKSDAWWMLWVALIALYPLYQLSYWISTSLGGGLWDMYIAIKRLADGDLSFRLNFF
GKDDFSLIAREIDRNADNMSEMVKAIGNNARTLANASDEFNLQAKQNDELAQFQHQFLDT
VAVAMDQMTAAIEEVSHNAANTSDHTKHNATAAADSKQRIAEAVRRIGQLTGQIDAASSA
VDQLSGNATEIGAVVTTINGISEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAGRT
QQATVEIQSMIEGLQSGSGQLADITHEIVEQAELGRAAIESVGSDVDTMADSIDQVFDMS
SQIAASAEEQSVSARDIASQLNEIRDQSQTIKETAERSVVLASELQQSSTELDGILSQYR
LQ