Protein Info for Shew_2257 in Shewanella loihica PV-4

Annotation: HAD family hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF00702: Hydrolase" amino acids 9 to 162 (154 residues), 64.2 bits, see alignment E=4.3e-21 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 11 to 162 (152 residues), 51.7 bits, see alignment E=1.3e-17 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 11 to 167 (157 residues), 50.1 bits, see alignment E=3.3e-17 PF12710: HAD" amino acids 11 to 159 (149 residues), 32.1 bits, see alignment E=3.1e-11 PF13419: HAD_2" amino acids 27 to 166 (140 residues), 62.7 bits, see alignment E=9.1e-21 PF13242: Hydrolase_like" amino acids 125 to 193 (69 residues), 31 bits, see alignment E=3.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2257)

Predicted SEED Role

"Predicted phosphatases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF75 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Shew_2257 HAD family hydrolase (RefSeq) (Shewanella loihica PV-4)
MQSFNNLFKGVIFDLDGTLVSSSLDFKALKQAVGCPLDQDILAFVQQLPTERAKKAHKII
TQAEHLDALSARAMSGALALLDFLLLQQIPTAIVTRNSRQAAELKIERCALPIDLILSRD
DGPAKPDPSCLLALAKLWQLPPSQIAYVGDHHYDIQAAKRAGMPSVLLSEQRAHGEQKTY
GEQHGASYIFRDLMALHRALPSISLCA