Protein Info for Shew_2252 in Shewanella loihica PV-4

Annotation: anthranilate synthase component II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 3 to 187 (185 residues), 186 bits, E=3.1e-59
• PF00117: GATase
  • amino acids 5 to 186 (182 residues), 176.6 bits, E=4.7e-56
• PF07722: Peptidase_C26
  • amino acids 74 to 172 (99 residues), 25.4 bits, E=1.1e-09

Best Hits

Swiss-Prot: 57% identical to TRPG_YERPE: Anthranilate synthase component 2 (trpG) from Yersinia pestis

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 100% identity to slo:Shew_2252)

MetaCyc: 49% identical to anthranilate synthase beta subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• chloramphenicol biosynthesis (1/9 steps found)
• superpathway of candicidin biosynthesis (2/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

See A3QF70 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Shew_2252 anthranilate synthase component II (RefSeq) (Shewanella loihica PV-4)
MKLYLLDNFDSFTYNLVDQFRSLGFEVVIYRNDLDAQFIADKLLQEQGKAALVLSPGPGA
PHEAGCLMALIGLLAGKVPMLGICLGHQAMIEHFGGKVERAKQVVHGKASPTIHNCQGIF
AGLPSPLPVARYHSLVATQVPDCLEVIATTEEMPMAISHKSVKAVGFQFHPESILTTLGS
QLLTQTLTYLTQDAQLSSGQGV