Protein Info for Shew_2218 in Shewanella loihica PV-4

Annotation: signal transduction histidine kinase regulating citrate/malate metabolism (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 879 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details PF22673: MCP-like_PDC_1" amino acids 117 to 225 (109 residues), 53.1 bits, see alignment E=6.3e-18 TIGR00229: PAS domain S-box protein" amino acids 490 to 611 (122 residues), 28.2 bits, see alignment E=8.7e-11 PF08448: PAS_4" amino acids 497 to 605 (109 residues), 57.6 bits, see alignment E=2.1e-19 PF02518: HATPase_c" amino acids 773 to 876 (104 residues), 27.2 bits, see alignment E=6.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2218)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF36 at UniProt or InterPro

Protein Sequence (879 amino acids)

>Shew_2218 signal transduction histidine kinase regulating citrate/malate metabolism (RefSeq) (Shewanella loihica PV-4)
MNGSQAPMVANEKDEAGSLNTQWKNSLTFKFTIVQFVVAVLIIASSIWLIFSTEKKHHMD
TQLSLSQNYGLAVIEQLQQVTSKIETLANTIGIVGETYRGQDEVVKELIPSLLDIGERHQ
LIAGGGIWPEPGMFGKQKTRNSFFWARDKHDEFQYLDNYNSAEGPGYHQAFWYLPAKYFQ
DGHTHWSKSYVDPYTKEVMITASVPMRADHSFIGVATVDIALRGLDKRFNFSDQNPLSKG
YILALDSYNNLLADPFDESDKQQTAMLGQPLSRLIQRYPQLAPIAKRIETMDQAFSQQIM
TSPAYRPEQLEKVLVQTPREERDRLTTLINASIRGSHGKTPIVTLELSSDPLFNEPVLVS
ILTMAQTQWKIILVTPLSSLASQANAIALKIGAFLLLAQLIALLILFIFQHKLFIRPIFQ
IVSALQSGNLGRLELDANKRHDEVGQLAKAFIARSNQLEIAYASLDASNLALEQQLAMQQ
LAQQELENKKELINSLLNASQNLICIKDTHGCYSLVNDKFCEVMGIERARVIGMRDSDLY
PAHIAEIINHHDHIILDSDQAQSFEQPMPTVHGERIYLITKYPIKDKDGNIIALGAMAVD
ISSLKAKQAELEQTIKLQGARNTELKQALDAKPQAMVKEGIDPKGLAQLKQIELAQQAIL
PQVVHQLLRQELQALEQIFIQLRQLDTADIDEPQLAKFTEALTSQIDIIRHGQSLISADI
TDVRATVADLFLQDLVAMLRPQLEAKGVAVEIDCPHHLTLPISPWHFLVLCHRLLGNSLQ
HAFPDGQALNRPKQLSLGIRYREGLLTLTLRDNGLGIGKARLEKLTHALDSSSNNNDKGQ
GSLIHINQWLKAHFNGRLTVSSQSAQFTELVCELHLDKA