Protein Info for Shew_2214 in Shewanella loihica PV-4

Annotation: integration host factor, alpha subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 TIGR00987: integration host factor, alpha subunit" amino acids 2 to 96 (95 residues), 170.5 bits, see alignment E=4e-55 PF00216: Bac_DNA_binding" amino acids 3 to 91 (89 residues), 109.8 bits, see alignment E=6.4e-36 PF18291: HU-HIG" amino acids 4 to 94 (91 residues), 32.5 bits, see alignment E=8e-12

Best Hits

Swiss-Prot: 100% identical to IHFA_SHELP: Integration host factor subunit alpha (ihfA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 100% identity to slo:Shew_2214)

Predicted SEED Role

"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF32 at UniProt or InterPro

Protein Sequence (98 amino acids)

>Shew_2214 integration host factor, alpha subunit (RefSeq) (Shewanella loihica PV-4)
MALTKAEMAEHLFETLGINKRVAKEMVEAFFEEIRQALENGEQVKLSGFGNFDLRDKNQR
PGRNPKTGEDIPISARRVVTFRPGQKLKSRVEEANAGK