Protein Info for Shew_2205 in Shewanella loihica PV-4

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 126 to 145 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 174 to 356 (183 residues), 143.1 bits, see alignment E=3.3e-46 PF00990: GGDEF" amino acids 179 to 353 (175 residues), 136 bits, see alignment E=5.1e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2205)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF23 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Shew_2205 diguanylate cyclase (RefSeq) (Shewanella loihica PV-4)
MARRFRQLTLKTTTCFACSLILLLSSQVAANASLTQPQPMLMPYALTSHALMPGTLAAPY
SMVATASPRLDQSGKPFQFAPAQSNLASVGLSQISKVSASPLHDPSRQVGFASSWLGELK
AHYPNLLLHYLAPLIAIALVMQRVYRQASTLSRTRLEQAIDERTQALQLENLRLQEMSHR
DPLTGLKNRRFIEEMIAQDLNRVDRSYDATQLRGEGTPSKADLLALIIDIDHFKPINDTY
GHLAGDRVLSQVGQRLTTLFRNYDYVVRWGGEEFLVVARFIDRQEINHLAEKVRHAIESM
EIELDAKRNIKITASVGAAPYPFSTAQADRISWEQVVHLADMALYQAKTSSRNTWVSYRG
SDQLPIPDELQLDPAKIPRIAMVSSKPLSRQSLDLRKASL