Protein Info for Shew_2199 in Shewanella loihica PV-4

Annotation: histidinol-phosphate aminotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR01141: histidinol-phosphate transaminase" amino acids 20 to 358 (339 residues), 321.7 bits, see alignment E=2.5e-100 PF00155: Aminotran_1_2" amino acids 48 to 355 (308 residues), 181.3 bits, see alignment E=1.7e-57

Best Hits

Swiss-Prot: 63% identical to HIS8_SHEON: Histidinol-phosphate aminotransferase (hisC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 100% identity to slo:Shew_2199)

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF17 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Shew_2199 histidinol-phosphate aminotransferase (RefSeq) (Shewanella loihica PV-4)
MSVEAKMSVNATSLAERLARPELLTLEPYQSARRIGGEGQIWINANESPFINSDLDSLNR
YPECQPPELITRYAEYAGVSNQQVLTSRGADEAIELLIRTFCIPGRDSIACFGPTYGMYA
ISAKTFNVGVKALRLDDEYQLPQELCSQVGDAKLVFICNPNNPTGTVIAPDAIEAVIRSL
PDTLVVVDEAYIEFCPDYSVASLLDKYDNLIVLRTLSKAFALAGARCGFMLATPEVIEMV
MRVIAPYPVPLPVAKLAIDALSKDGIARMQTQVAQLKANGQRLADALREAGARVLPAYGN
FVLAYFDQANEIKVGEMQARLKQTGVVARAYKDPALADAIRFSFASDAQTETLIAILKAD