Protein Info for Shew_2185 in Shewanella loihica PV-4

Annotation: septum site-determining protein MinD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF10609: ParA" amino acids 2 to 244 (243 residues), 56.6 bits, see alignment E=7.9e-19 TIGR01968: septum site-determining protein MinD" amino acids 2 to 267 (266 residues), 369.2 bits, see alignment E=5.4e-115 PF13614: AAA_31" amino acids 3 to 167 (165 residues), 74.8 bits, see alignment E=2.5e-24 PF09140: MipZ" amino acids 4 to 143 (140 residues), 36.8 bits, see alignment E=8.3e-13 PF06564: CBP_BcsQ" amino acids 4 to 148 (145 residues), 22.2 bits, see alignment E=2.7e-08 PF01656: CbiA" amino acids 5 to 226 (222 residues), 68.6 bits, see alignment E=1.5e-22 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 34.3 bits, see alignment 4.6e-12

Best Hits

Swiss-Prot: 78% identical to MIND_SHIFL: Septum site-determining protein MinD (minD) from Shigella flexneri

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 100% identity to slo:Shew_2185)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF03 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Shew_2185 septum site-determining protein MinD (RefSeq) (Shewanella loihica PV-4)
MAQIIVVTSGKGGVGKTTSSAAIATGLALKGHKTVVVDFDIGLRNLDLIMGCERRVVYDF
VNVINGEANLNQALIKDKRTSNLFVLPASQTRDKDALTKEGVGRVLDELKQEFEYIICDS
PAGIETGAMMALYFADTAIVTTNPEVSSVRDSDRILGMLQSKSKRAEEGLEPVKELLLLT
RYSPTRVATGEMLSVADVEEILAIPLLGVIPESQAVLKASNSGVPVIIDQESDAGKAYSD
AVARLTGEDVEMRFVTEEKKGFLKRIFGS