Protein Info for Shew_2172 in Shewanella loihica PV-4

Annotation: surface antigen (D15) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details PF17243: POTRA_TamA_1" amino acids 53 to 126 (74 residues), 70 bits, see alignment E=2.2e-23 PF07244: POTRA" amino acids 136 to 207 (72 residues), 25.8 bits, see alignment E=2.2e-09 PF01103: Omp85" amino acids 340 to 634 (295 residues), 128.3 bits, see alignment E=7.3e-41

Best Hits

KEGG orthology group: K07278, outer membrane protein (inferred from 100% identity to slo:Shew_2172)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEZ0 at UniProt or InterPro

Protein Sequence (636 amino acids)

>Shew_2172 surface antigen (D15) (RefSeq) (Shewanella loihica PV-4)
MASIICDNKQQQTFQLDRAFFLRIFATLSRLSILALLSFSMGISPVWANDWLKVEVDGAN
ESLKRNITAHLGALPGSEVQRRAYIFNAEENIEAALHSLGYYKGKIDQQLESPESGPWTL
RLTVTPGAPTVIQWIDIQLSGEILDDEVINAWLRQIKVKPGDVLNHGEYEAIKSQLLTYA
LARGYFEGKYLTNKIVVNRDLDSAQISLHYDSGPRYRIGEVSFNGHDLVPGFLDKLIPFE
PDSHYSTGKIGALNRELVDTGYFTNIKVLPQLDKMQDDRVPIRVEVTPKPSHSIELGLGA
DIGNSIDNNIEPRVRVTWRTPQINRYGHSQETSLEWSPDRPKFLTTYTIPLTHPLDDQLK
LRLGLLRDKYGVTQIYDPDKRDYRNTGELESVKKLVGVVRQKRLHNQWLFTYSLDAINEE
YTQSDIKYNPDILLLGTSLSKTNRGDKSLDPKSGFFQYYSLEHADPSLGSDLRLTRLQAK
FKWIDTFFDKHRFVSRLDLGANLVSEEDLPMVPPSLRYFAGGDQSIRGYSYQELGPYIEY
TNSQDQLARMVVGGRYLMVGSLEYQYYLTPTWRLATFVDAGNAFDNQQFEPIVSVGGGVH
WISPIGPIKLDLGVGLKETETVDRSWRIHITMGAEL