Protein Info for Shew_2164 in Shewanella loihica PV-4

Annotation: acyl-CoA dehydrogenase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 515 to 536 (22 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 79 to 157 (79 residues), 41.3 bits, see alignment E=4.7e-14 PF02770: Acyl-CoA_dh_M" amino acids 162 to 270 (109 residues), 48.2 bits, see alignment E=2.5e-16 PF00441: Acyl-CoA_dh_1" amino acids 282 to 450 (169 residues), 52.8 bits, see alignment E=1.3e-17 PF22924: ACOX_C_alpha1" amino acids 293 to 447 (155 residues), 30.2 bits, see alignment E=9.3e-11 PF12806: Acyl-CoA_dh_C" amino acids 471 to 590 (120 residues), 98.7 bits, see alignment E=6.9e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2164)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEY2 at UniProt or InterPro

Protein Sequence (596 amino acids)

>Shew_2164 acyl-CoA dehydrogenase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MPIYQAPLRDYQFILSELLNIYGRDDLQGFDEIDAELTDAILQGVADFTTEIMLPLNSQG
DTQGCQLVDGQVRTPEGFKDAYQQYVDNGWATLTSDPEYGGQGLPECIGVFATEMKTATN
MAFAMYPGLTHGAYAAIHAHGSDALKAKYLEKLVSGEWTGTMNLTEAHAGTDLALLRTKA
KPVGEDTYAISGEKIFISSGDHDLADNIVHLVLARLPDAPDGVKGISLFAVPKYLVNDDG
TLGCRNGVEASALEHKMGIHGNSTCVMVFDGAIGELVGEPHQGLRAMFTMMNEARLGVGV
QGLGVSEIAYQNALSYARERLQGRALSGVKESESPADPILVHGDVRRMLMAQKAFNQGAR
ALMGQQALWLDESHRHQDKAKATIAAKLAALFTPVVKGFVTDQGFKACVDAQQVYGGHGY
IHEWGMEQFVRDSRIAMIYEGTNGVQALDLVGRKLLADKGEALGLWSEMVKPFVAKYLED
EALKPYLMPLMEATTDLEKATQYIVANGVKNPDIIGAASMGYLQILGIVALGWMWARMAV
KSQQAMTAGEEEAFYANKLVTAKFYMSYWAPQTRSIRYQMERSCELLTQLQDSDFD