Protein Info for Shew_2144 in Shewanella loihica PV-4

Annotation: response regulator receiver modulated CheW protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF01584: CheW" amino acids 21 to 159 (139 residues), 115.9 bits, see alignment E=1.1e-37 PF00072: Response_reg" amino acids 185 to 304 (120 residues), 44.6 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 100% identity to slo:Shew_2144)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEW2 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Shew_2144 response regulator receiver modulated CheW protein (RefSeq) (Shewanella loihica PV-4)
MAKVLESVDQRTQLVGENRLELLLFRINATQLFAINVFKVKEVVKLPKLSALPGSHPSIK
GVANIRGTSIPVIDLRAAIGFQPMNSDQEANLIITEYNRSVQGFMVGKVDHIINMTWSDI
MPPPKSTGSHNYLTAITKVEVDGATRLVSIIDVEKVLAEIVHYDIAISEGVLDEALVDKM
IGRKILIADDSATARRQVKDTLAPLGIEVIETSDGLQALKLLKRWCDEGRDINQEILMLI
TDAEMPEMDGYRLTYEVRNDKRMANLFITLNTSLSGSFNNAMVEKVGCDRFISKFQPDLL
VDVVQERLRTQLPEQVN