Protein Info for Shew_2136 in Shewanella loihica PV-4

Annotation: carboxylesterase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF02230: Abhydrolase_2" amino acids 10 to 218 (209 residues), 186.3 bits, see alignment E=1.4e-58 PF03959: FSH1" amino acids 99 to 211 (113 residues), 27 bits, see alignment E=6.7e-10

Best Hits

Swiss-Prot: 34% identical to SOBRL_ARATH: Probable carboxylesterase SOBER1-like (At4g22300) from Arabidopsis thaliana

KEGG orthology group: K01044, carboxylesterase [EC: 3.1.1.1] (inferred from 100% identity to slo:Shew_2136)

Predicted SEED Role

"Phospholipase/carboxylesterase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEV4 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Shew_2136 carboxylesterase (RefSeq) (Shewanella loihica PV-4)
MSQQPLERITIEPQSQFRACVIWLHGLGDSGAGFAPVVPLLGLPDELGVRFIFPHAPSIP
VTINQGYVMPAWYDIKGMDVDNRADMAGVLASELAIAALIEEQIASGVPSDKIVLAGFSQ
GGVMSLFTGLRFPKRLAGIMALSCYLPTGHAMPDNLSEANRSTPLLQQHGEQDEVVPLAL
GRAAYDLISKAGYSSEWHTYPMGHSVLPNQLQEIGLWLKARLSL