Protein Info for Shew_2126 in Shewanella loihica PV-4

Annotation: ATPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF20030: bpMoxR" amino acids 6 to 183 (178 residues), 28.3 bits, see alignment E=2.6e-10 PF00493: MCM" amino acids 30 to 149 (120 residues), 25.1 bits, see alignment E=2.6e-09 PF07726: AAA_3" amino acids 36 to 166 (131 residues), 208.8 bits, see alignment E=7.1e-66 PF07728: AAA_5" amino acids 43 to 164 (122 residues), 43.4 bits, see alignment E=1.1e-14 PF17863: AAA_lid_2" amino acids 237 to 289 (53 residues), 59.7 bits, see alignment 6e-20

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to slo:Shew_2126)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEU4 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Shew_2126 ATPase (RefSeq) (Shewanella loihica PV-4)
MSHTSITAILNQLQRVLLGKPHQIKLALTCILAKGHLLIEDLPGMGKTSLSQGMAQSLGL
SHQRIQFTSDMLPADILGVSIFDKEQSQFVFHPGPIFKQMILADEINRASPKTQSALLEA
MAEQQITVDGVTHALPSPFFVIATQNPSEQSGTFPLPESQLDRFMMRISIGYPDETAELA
MLKGEDISPQQQHLPACVDPLTLIELQSQVTKVKASEALLNYILALVKGSRQLNEGYGLS
PRASKALLNAAKAWAFIQGRNYLVPDDVQAVFASVAEHRLRHTSQQQGEALSQRLLASTN
PIL