Protein Info for Shew_2125 in Shewanella loihica PV-4

Annotation: lytic transglycosylase, catalytic (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00760: Cucumo_coat" amino acids 155 to 208 (54 residues), 24.7 bits, see alignment 2.4e-09 PF14718: SLT_L" amino acids 407 to 473 (67 residues), 84.1 bits, see alignment E=9.7e-28 PF01464: SLT" amino acids 484 to 596 (113 residues), 100.9 bits, see alignment E=5.3e-33

Best Hits

KEGG orthology group: K08309, soluble lytic murein transglycosylase [EC: 3.2.1.-] (inferred from 100% identity to slo:Shew_2125)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEU3 at UniProt or InterPro

Protein Sequence (645 amino acids)

>Shew_2125 lytic transglycosylase, catalytic (RefSeq) (Shewanella loihica PV-4)
MPKRLGTLFQAKRYLLLGLGALIPMTLSAAGLTPTQQRYLDAREALDKGQLDSYQALRKQ
LNGYPLTPYLDYHAEIDSILDAPGAKALESMARFDGTPLYNSARHRYLENAGKQKHWQDF
LAMSPELPRSINLQCYYYRAQLSQGDKAAAFDGAEKLWLHGHSRPKECDPLFNAWEKAGN
RSQSLLWSRMLLAFNGGEYGLLKYLASKVTAHKKEAKQLLAVYQDPRSLRHTKRFKVKAT
IYGDIVDAGLRRLARKDLVKAVSLFTKYEKAHRFSDYQGQKLARYLMKRALVAQETELKA
FVDSRLPKTDSDDLKALRLRWAIREADNQSLDNYLPLLSEAKRQKARWQYWIARRQMETG
TEMAETALPSLSKQRNFYGFTAADLISTSINLAQIDTQLDESLTPQLTQDPGLARVEELL
ALDKKIDARAEWVLLLGRHTQNKQAQYALLAQRNQWHDLTVQASIQGQLWNDMTLRFPYA
ADEAFKAASKSAKVDIDEIRAIARRESAFYPYATSGVGARGLMQLMPATAKETARKHGMK
YSGSKSLYDVSLNTALGSRYYKSLLDKFDGNRVLATAAYNAGPHRVTRWLEQSQGKLDVY
AFIESIPFTETREYVQAVLSYRAIYQARQQKPVALFSAEELAFKY