Protein Info for Shew_2117 in Shewanella loihica PV-4
Annotation: ribonuclease activity regulator protein RraA (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to RRAAH_SHEON: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (SO_2567) from Shewanella oneidensis (strain MR-1)
KEGG orthology group: K02553, regulator of ribonuclease activity A (inferred from 100% identity to slo:Shew_2117)Predicted SEED Role
"Ribonuclease E inhibitor RraA" in subsystem RNA processing and degradation, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QET5 at UniProt or InterPro
Protein Sequence (164 amino acids)
>Shew_2117 ribonuclease activity regulator protein RraA (RefSeq) (Shewanella loihica PV-4) MQDLLPDLFDHYETQLSLLAPHYRQFGQKRIFWGEVVTVKCFEDNSKVKQLLGQLGEGRV LVVDGGGSNRRALLGDMIAQSAVDNGWSGIVINGYVRDVGALAQMPIGIQALGANPIKTD KRDLGDVNVTLEIDRVIIKPGMMLYADDNGVAVSSEQLDLSQLA