Protein Info for Shew_2109 in Shewanella loihica PV-4

Annotation: sodium/hydrogen exchanger (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 243 to 259 (17 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 385 (371 residues), 130 bits, see alignment E=5.3e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2109)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QES7 at UniProt or InterPro

Protein Sequence (643 amino acids)

>Shew_2109 sodium/hydrogen exchanger (RefSeq) (Shewanella loihica PV-4)
MVEKITAMLGLVGILSIVCQWLGWRLRLPAILPLLLCGLLVGPVFNLLDPDAIFGDLLFP
VISLGVAVILFEGALTLNFSEIREHGRMVTHLVSLGTLVTWICIGVATHFIMGFSWELAM
LFGALVVVTGPTVIVPMLRSIKPKSQLASILRWEGIVIDPIGALLAVLVFEYLTVAAEPA
SHVLLSLFSMLGVGLGLGVLFGYGIGVMLRRAWVPHYLKNTAVLTIMLGAFVASNLLQEE
SGLLTVTVMGIWLANMRGVDIGEIIEFKETLTVLFISGLFILLAARLDSTALMQLGWQGL
ALLLVVMFIARPLSVWCCAVGTSLPRADKWFLSWVAPRGIVAAAVSSLFAIKLERLEVAG
ADKIVPLVFLIIIGTVVSQSLTAGAWARFLGVKAGSAQGLLIFGASKFARELAKVLLQKN
VSVVLADNNWDNIRLSRMDNIPVYFGNPASEHADNALDMTGLGRLLVLSPYRQLNPLVTF
HFQDILGKNKVFGLGSGEGNSARHQLSESYLERLCLFGDNVTYARLASTIAKGGKIKSTS
LTENFSFADFKQRYGEGALPLIYLQEGKVKLIIQAVDDLPVGIELISLLSEEALNEALLA
DEKKAAASLEDGECVPSTSVDGSQESKGSQVPSAVTADEKAAG