Protein Info for Shew_2098 in Shewanella loihica PV-4

Annotation: hemolysin III family channel protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details PF03006: HlyIII" amino acids 33 to 228 (196 residues), 129.1 bits, see alignment E=1e-41 TIGR01065: channel protein, hemolysin III family" amino acids 35 to 234 (200 residues), 205.7 bits, see alignment E=2.8e-65

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to slo:Shew_2098)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QER6 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Shew_2098 hemolysin III family channel protein (RefSeq) (Shewanella loihica PV-4)
MPPQSVPPQTIQPHEIGLNSQPSFAATAAPYSRAEELANALSHGLGVIAGILALAFSLHK
GWDRLTNLQLGGLALYCLSIILLFLCSTLYHSVSAPKLKHKLKIADHCAIYLLIAGTYTP
LMQILLDSVEADAILIAIWSLALGGILFKTLFIHRFKIFSLVLYLVMGWLCVIVMKQLLA
AMTPLGFQLLLAGGIFYSTGVIFYVGKRIPYNHAIWHLFVLAGALSHFLCVYLTVI