Protein Info for Shew_2091 in Shewanella loihica PV-4

Name: thiH
Annotation: thiamine biosynthesis protein ThiH (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR02351: thiazole biosynthesis protein ThiH" amino acids 3 to 365 (363 residues), 537.5 bits, see alignment E=7.3e-166 PF04055: Radical_SAM" amino acids 80 to 234 (155 residues), 54.7 bits, see alignment E=1.5e-18 PF06968: BATS" amino acids 256 to 357 (102 residues), 59.3 bits, see alignment E=3.6e-20

Best Hits

Swiss-Prot: 50% identical to THIH_SALTY: 2-iminoacetate synthase (thiH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03150, thiamine biosynthesis ThiH (inferred from 100% identity to slo:Shew_2091)

MetaCyc: 50% identical to 2-iminoacetate synthase (Escherichia coli K-12 substr. MG1655)
RXN-11319 [EC: 4.1.99.19]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEQ9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Shew_2091 thiamine biosynthesis protein ThiH (RefSeq) (Shewanella loihica PV-4)
MSFFDTLSGLSREQLRMALYSTTPAQVETAIEGEQGNLGHLLALLSPAAEEYLEPMAQRA
AALTRQRFGHNIGLYLPLYLSNLCANECDYCGFTMSNKLKRKVLSHDELAAEMAVIKPQG
FDSILLVSGEHETKVGIEYFADILPLVKAEFSHVAMEVQPLSREHYEILVEKGLDAVMLY
QETYDPETYRRHHLRGNKQDYGYRLASPERIAQAGVDKIGLGVLLGLDDWRMDALLMGYH
LDYLERRFWRSRYSISLPRLRPCVGGITPKVQLTDKGLVQLICAFRLFNEQLEISLSTRE
TPSLRDNLLGLGITQMSAGSRTEPGGYVNPAAQLDQFEISDERSAAEVASVLRSRGFTPV
WKDWEAGWIGAG