Protein Info for Shew_2085 in Shewanella loihica PV-4

Annotation: alpha-L-glutamate ligase-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR02291: alpha-L-glutamate ligase homolog" amino acids 4 to 314 (311 residues), 450.7 bits, see alignment E=1.2e-139 PF14397: ATPgrasp_ST" amino acids 20 to 293 (274 residues), 323.3 bits, see alignment E=2.5e-100

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2085)

Predicted SEED Role

"FIG002781: Alpha-L-glutamate ligase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEQ3 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Shew_2085 alpha-L-glutamate ligase-like protein (RefSeq) (Shewanella loihica PV-4)
MLFAKPRKLKENGVLGMNKRNIDYIGRYNPRKFYKRVDDKLTTKQLALANDIAVPALIGT
VCQQHEIMHIPEMVNNRDGFVIKPSQGSGGKGILVITKVENGHYFKPNGHEVTPSEIDRH
ISNILSGLFSLGGKPDVAIVEGLIEFDPVFDGYSFEGVPDIRLIVFKGFPVMGMLRLSTA
ASDGKANLHQGAVGVGLDIGTGRGLHAVQFDRPLDLHPDTDKKLTEIQVPHWDTLLHTAS
KAYEMSELGYLGTDMVLDQKLGPLLLELNARPGLAIQIANGQGLLPRLKHVEQMKNKSMS
VEERVAYAKTHFSSLPSA