Protein Info for Shew_2084 in Shewanella loihica PV-4

Annotation: gonadoliberin III-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 25 to 25 (1 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 338 to 366 (29 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 437 to 460 (24 residues), see Phobius details amino acids 463 to 487 (25 residues), see Phobius details PF14400: Transglut_i_TM" amino acids 24 to 183 (160 residues), 185 bits, see alignment E=1e-58 PF14402: 7TM_transglut" amino acids 255 to 498 (244 residues), 359.3 bits, see alignment E=1.1e-111

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2084)

Predicted SEED Role

"FIG139976: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEQ2 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Shew_2084 gonadoliberin III-related protein (RefSeq) (Shewanella loihica PV-4)
MHSKKPFYILVALLFIAGIAASVYRGIEHNVPFLPGEQVQSWAVDAKVSFQGTGEPAEVT
FSLPKDPAFEILAENATSPGYGLSATEDDTGRQVTWSTREAIGQQDLYYKVTLVPTGKNE
IPADKEPDAPQAYNWPATEKAAAEQVMSEIWSRSATNLSFAQQLNKSFNATERSQNLELL
LTSNSRAELFIHMLNSKGIPAKKVSGLFLEDQRRRQQLTNYVEVYHQGQWIIFNPNDGTQ
GRPDNLLIWDRTAKSTLDVVGGVNSQVNFSMLQDTRSALATSIDMLKNKNALDFSLYQLP
LEEQSLFKGILLIPIGVLMVVFLRVIIGIKTSGTFMPVLIALAFIQTTLLTGLVGFLLIV
AFGLMIRSYLSDLNLLLISRISAVIIVVIGIIGLFTLLSYKFGLSEGLTITFFPMIILAW
TIERMSILWEEEGAKEVMVQGGGSLFVATLAYLAMSATWVQHWVFNFLGIHLVILATVLL
MGQYTGYKLLELRRFRPLAGE