Protein Info for Shew_2082 in Shewanella loihica PV-4

Annotation: putative methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 7 to 322 (316 residues), 542.3 bits, E=9.5e-167
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 7 to 320 (314 residues), 495.6 bits, E=2.2e-153
• PF13489: Methyltransf_23
  • amino acids 121 to 270 (150 residues), 53.4 bits, E=7.7e-18
• PF13847: Methyltransf_31
  • amino acids 122 to 228 (107 residues), 39.7 bits, E=1.3e-13
• PF13649: Methyltransf_25
  • amino acids 126 to 220 (95 residues), 42.3 bits, E=3e-14
• PF08241: Methyltransf_11
  • amino acids 127 to 224 (98 residues), 41.6 bits, E=5e-14
• PF08242: Methyltransf_12
  • amino acids 127 to 222 (96 residues), 39.4 bits, E=2.6e-13

Best Hits

Swiss-Prot: 100% identical to CMOB_SHELP: tRNA U34 carboxymethyltransferase (cmoB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_2082)

MetaCyc: 63% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (2/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A3QEQ0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Shew_2082 putative methyltransferase (RefSeq) (Shewanella loihica PV-4)
MISFSSFYQQIADSNLQHWLEELPAILGQWQREHKHGNLPKWEKVLNKLHYPAPDRIDFT
TRVEVGSGDQLSKGQQEKLKNLLKLFCPWRKGPFDLHGIHIDTEWRSDWKWERVQPHISP
LKNRTVLDVGCGSGYHMWRMLGDGAKRVVGIDPSPLFLCQFEAVKRLAGNDHPVHLLPLG
IEQLPPLDAFDTVFSMGVLYHRRSPIDHLLQLRDQLRTGGELVLETLVVDGDENTVLVPG
ERYGKMNNVWFLPSAKALEAWLKKADFVDVRCVDIDVTSLAEQRSTEWMPNESLVDYLDP
NDVSLTVEGYPAPKRATFIAVKNQPNKDLV