Protein Info for Shew_2071 in Shewanella loihica PV-4

Annotation: SoxR-reducing system protein RsxE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 22 to 58 (37 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 5 to 200 (196 residues), 223.4 bits, see alignment E=1e-70 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 7 to 209 (203 residues), 283.8 bits, see alignment E=3.2e-89

Best Hits

Swiss-Prot: 100% identical to RNFE_SHELP: Ion-translocating oxidoreductase complex subunit E (rnfE) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 100% identity to slo:Shew_2071)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEN9 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Shew_2071 SoxR-reducing system protein RsxE (RefSeq) (Shewanella loihica PV-4)
MSNYRDIAWQGLWKNNPGLVQLLGLCPLLAVTATLTNAIGLGLATLVVLVGSNVLVSLVR
EFVPKEIRIPVFVMIIAALVTCVQLLINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS
RNSVVKAAFDGLMMGLGFTLVLMLLGACREILGQGTLFDGADLLLGDWAKGLTIHLWQVD
TNFLLAMLPPGAFIAMGFLIAIKNMIDKQLEARKPALEAAPAVTRARITKVS