Protein Info for Shew_2063 in Shewanella loihica PV-4

Annotation: rhomboid family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details TIGR03902: rhombosortase" amino acids 33 to 183 (151 residues), 183.6 bits, see alignment E=1.2e-58 PF01694: Rhomboid" amino acids 44 to 186 (143 residues), 55.9 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2063)

Predicted SEED Role

"Membrane protein, Rhomboid family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEN1 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Shew_2063 rhomboid family protein (RefSeq) (Shewanella loihica PV-4)
MLGRLTSRATPYGVVLGISILCSLLYFLHLDGTLAFRRSAIAHGEWWRLVSGNLLHTNHW
HLLMNLAGLWVISFLHENHYRAGNFTLLFALLCLLQGLGLYWFFPILGGYVGLSGMLHGL
FAYGALKDIQMKIRSGYLLFAGVCFKVAYEQYYGATDQITKLIDARVATEAHLVGVISGV
LVFLLYRLIRRLAR