Protein Info for Shew_2062 in Shewanella loihica PV-4

Annotation: exsB protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06508: QueC
  • amino acids 3 to 212 (210 residues), 271.4 bits, E=4.7e-85
• TIGR00364: queuosine biosynthesis protein QueC
  • amino acids 4 to 205 (202 residues), 268.5 bits, E=1.6e-84
• PF00733: Asn_synthase
  • amino acids 6 to 60 (55 residues), 22.4 bits, E=8.8e-09

Best Hits

Swiss-Prot: 100% identical to QUEC_SHELP: 7-cyano-7-deazaguanine synthase (queC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 100% identity to slo:Shew_2062)

MetaCyc: 68% identical to 7-cyano-7-deazaguanine synthase (Escherichia coli K-12 substr. MG1655)
RXN-12093 [EC: 6.3.4.20]

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

• preQ₀ biosynthesis (2/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.20

Sequence Analysis Tools

See A3QEN0 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Shew_2062 exsB protein (RefSeq) (Shewanella loihica PV-4)
MSKAVVVFSGGQDSTTCLIQALNQYDEVHAVTFDYGQRHSEEIATAAKLAKDLKVDSHKI
LDVTVLNELAISALTRDAIPVSNELMDNGLPNTFVPGRNILFLTLAGIYAYQLGAESVIT
GVCETDFSGYPDCRDSFIKAMQSALEQGMDRELKLVTPLMWLNKAQTWALADKYHSLELV
RDQTLTCYNGIVGSGCGTCPACLLRAKGLNDYLDDKAGVMAELDAKC