Protein Info for Shew_2061 in Shewanella loihica PV-4

Annotation: radical SAM domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR04322: putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE" amino acids 9 to 222 (214 residues), 358.3 bits, see alignment E=6.3e-112 PF04055: Radical_SAM" amino acids 29 to 123 (95 residues), 34.2 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 47% identical to QUEE_BUCAP: 7-carboxy-7-deazaguanine synthase (queE) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: K10026, queuosine biosynthesis protein QueE (inferred from 100% identity to slo:Shew_2061)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEM9 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Shew_2061 radical SAM domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MKYPVNEVFETIQGEGVYTGVPAIFVRLQGCPVGCSWCDTKHTWETLAENRVSSEQVIQV
DGAIGRWAELDARELLMHFKVQGFSAKHVVITGGEPCIYDLIALTQAFADAGMQCQIETS
GTFDVLVDPRAWVTVSPKINMKGGYKVLEQALERADEIKHPVAKASHIEELDELLKGIDT
LGKTICLQPISQKPRATELAMKVCIERNWRLSIQTHKYLNID