Protein Info for Shew_2057 in Shewanella loihica PV-4

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 PF01590: GAF" amino acids 26 to 168 (143 residues), 48.6 bits, see alignment E=3.7e-16 TIGR00229: PAS domain S-box protein" amino acids 183 to 302 (120 residues), 34.4 bits, see alignment E=2.2e-12 PF00989: PAS" amino acids 186 to 291 (106 residues), 23.3 bits, see alignment E=1.7e-08 PF13426: PAS_9" amino acids 195 to 293 (99 residues), 35.8 bits, see alignment E=2.4e-12 PF08448: PAS_4" amino acids 203 to 294 (92 residues), 23.3 bits, see alignment E=1.9e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 302 to 456 (155 residues), 76.7 bits, see alignment E=1.8e-25 PF00990: GGDEF" amino acids 310 to 453 (144 residues), 92.2 bits, see alignment E=9.6e-30 PF00563: EAL" amino acids 476 to 709 (234 residues), 241.6 bits, see alignment E=2.3e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2057)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEM5 at UniProt or InterPro

Protein Sequence (729 amino acids)

>Shew_2057 diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s) (RefSeq) (Shewanella loihica PV-4)
MTKRQFQHLLETIVNSTQKQEGQFKETAELACDLLSQSLKVDNIGVCLFSGCETSELIAL
SGSQSQASFNQSSLNHASRPAQGLCPNYFEQLKRGRIIDVIDVEQDCRVAEIREHLTANA
VVSHLDVAIRINGHLEGVLYLESLHPHEWPESEIHIVSQVADQLALTLATQRAYDTDERL
SLFLKAIEQSEQISMVVNLATDKIEYVNGAHHAISGVPKQQILGKSLACLDFFKQSPVQA
DAVLAQVKQGKITKGNTQLTRRDGESYWLRYRVRPFTTPRGNHYALVTAEDCSEELVQQN
ELERLAWRCSLTGLYNRSYFNRALEKLRSGHLMLIDLRGFKRFNDTYGHEKGDSLLIEVA
RRIKHFASVKKAELMARVGSDEFALVLQGVEDEQSLDYAIKRLYHQLSLPVQVGAESFEA
KPALSVVEIDALEAGFSALTCADIAVQYAKKKQGSAIQIFNHALLNTFKEDAQIERDLQA
ALKNREFELYYQPLKDLGRQAYIGAEALIRWHHPKKGVLYPGAFIDIAEQTGMIAAIGEW
VLEAACRQLNLWQHHNINISMHVNVSARQFFSTQLYDQVWQLVTRYRIRPNTLILEITET
ELMEDVVYATHLCKELAELGVGLAIDDFGTGYSSMRYLKQFPISKLKIDRSFISDLSVSR
ESREIVSAIIAMAKALNLSLTAEGVETAEQESFLSALSCHQAQGFLYSPALREAEFSQFL
RANAETPLH