Protein Info for Shew_2041 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details PF08019: EptA_B_N" amino acids 55 to 205 (151 residues), 160.7 bits, see alignment E=2.6e-51 PF00884: Sulfatase" amino acids 233 to 524 (292 residues), 211.7 bits, see alignment E=1.6e-66

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 100% identity to slo:Shew_2041)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEK9 at UniProt or InterPro

Protein Sequence (542 amino acids)

>Shew_2041 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MLSRVKTLSVNQFTLITALFYVGVFNIPLFQIVQQGIEKQGEVNYLFIATIPLFLIFALS
FIFSLFSVKYLLKPFFIIVTLISSSVFFAALQYGVVFDYGMIENTVQTNSAEALTYLNWS
SILNFTLTGLLPALLIFKADIVYKPFVKELLHKLAFMFAMLAGIAVIGFFYYQNYVAFGR
NNDQMKRYIVPTYAIGSMIKYVKVNYFQEPLVYKVQGKDAKNLTLDHNDKPNLVVVVVGE
TARAHNYEYYGYDKPTNAHTKAYDMIAFKDTESCGTATAVSLPCMFSSMDREDYDARKAQ
AQDTAMDVLDHAGISLDWLDNDSGCKGVCDRVKHINIDLNSDPELCDGHYCYDQVLLNEL
DKRLAEGVTKDTLIVLHIIGSHGPTYYLRYPEAHRKFVPDCQRSDIQNCSDEELMNTYDN
TILYSDYIIAQVISRLEAQQNKADTALLYVSDHGESLGESGMYLHGAPYAIAPDEQIKIP
MLAWLSADFASDNGLDKQCLRDHATKGGFSHDNLFSSLLGLMNVSTEVYRKEKDLFATCR
VK