Protein Info for Shew_2037 in Shewanella loihica PV-4

Annotation: MATE efflux family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 349 to 365 (17 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details PF01554: MatE" amino acids 17 to 176 (160 residues), 101.1 bits, see alignment E=2.6e-33 amino acids 243 to 404 (162 residues), 113.1 bits, see alignment E=5.6e-37 TIGR00797: MATE efflux family protein" amino acids 17 to 421 (405 residues), 342.1 bits, see alignment E=2e-106

Best Hits

Swiss-Prot: 75% identical to NORM_SHEON: Probable multidrug resistance protein NorM (norM) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 100% identity to slo:Shew_2037)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEK5 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Shew_2037 MATE efflux family protein (RefSeq) (Shewanella loihica PV-4)
MNQFGFQAKKLVHLALPVLIAQVTQTMMGFIDTVMAGRVSALDMAAVAIGGSLWLPALLF
VQGLLVAFTPVFASHHGADNQNAIRPMAFQAAYIAIIGAAVVISILLFAPQIFKLMDLSP
ELAELSVSYLHGFAWGVPAFVLYQVLRGCSEGISYTLPTMVIGFVGLAVNIPANYIFIYG
HLGAPALGGAGCGIATALVFWAMFIAMTIYMQWHKRFAVIKPLGAFHLPDLKTMKRMTKH
GMPIAMALFFEVSLFAIIALLLAPLGADVVAGHQIALNFSSIVFMLPLSIGIAVSIRVGY
YLGQYKADVAKLVTKVGLAIAFSLAACTAVITVVFRTQIALLYNQNPEVVALASSLMFLA
ALYQLSDSVQVVTAGALRGYHDTRSAFYITLVSYWAIGMVLGYLLAETDILVPAMGAHGF
WIGLIAGLTSAALLFALRLQYIQKHPKQLALVDQPINHADL